rplD:Gene
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
| Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
| Nomenclature | Location(s) and DNA Sequence | Sequence Features | Alleles and Phenotypes | Genetic Interactions | Genetic Resources | Accessions | Links | References | Suggestions |
<protect>
Nomenclature
See Help:Gene_nomenclature for help with entering information in the Gene Nomenclature table.
| Standard name |
rplD |
|---|---|
| Mnemonic |
Ribosomal protein, large |
| Synonyms |
ECK3306, b3319, JW3281, eryA[1], eryA |
| edit table |
</protect>
Notes
Location(s) and DNA Sequence
<protect>
See Help:Gene_location for help entering information in the Gene Location and DNA sequence table.
| Strain | Map location | Genome coordinates | Genome browsers | Sequence links |
|---|---|---|---|---|
|
MG1655 |
74.35 minutes |
MG1655: 3450308..3449703 |
||
|
NC_012967: 3380191..3379586 |
||||
|
NC_012759: 3336860..3337465 |
||||
|
W3110 |
|
W3110: 4188130..4188735 |
||
|
DH10B: 3548053..3547448 |
||||
| edit table |
</protect>
Notes
Sequence Features
See Help:Gene_sequence_features for help in entering sequence features in EcoliWiki.
| Feature Type | Strain | Genomic Location | Evidence | Reference | Notes |
|---|---|---|---|---|---|
|
Coding Start (SO:0000323) |
3449703 |
Edman degradation |
| ||
| edit table |
<protect></protect>
Notes
Alleles and Phenotypes
See Help:Gene_alleles for how to enter or edit alleles and phenotypes in EcoliWiki.
| Allele | Nt change(s) | AA change(s) | Phenotype: Type | Phenotype: Description | Reference | Availability | Comments |
|---|---|---|---|---|---|---|---|
|
rplDL134P |
L134P |
Does not regulate the S10 operon in vivo |
seeded from UniProt:P60723 | ||||
|
rplDDATGIDPVSLIAFDKVVMTADAVKQVEEMLA171RRSK |
DATGIDPVSLIAFDKVVMTADAVKQVEEMLA171RRSK |
Loss of S10 operon regulation. Assembles into ribosomes in vivo |
seeded from UniProt:P60723 | ||||
|
rplDA160V |
A160V |
Does not regulate the S10 operon; assembles into ribosomes in vivo |
seeded from UniProt:P60723 | ||||
|
rplDV167D |
V167D |
Does not regulate the S10 operon in vivo |
seeded from UniProt:P60723 | ||||
|
rplDK63E |
K63E |
(in strain: N282; confers erythromycin resistance. Ribosomes bind erythromycin poorly and have reduced peptidyltransferase activity. 50S subunits assemble normally, even in the presence of drug, but assembly is cold- sensitive at 20 degrees Celsius) |
Strain variation; seeded from UniProt:P60723 | ||||
|
rplD |
Deletion | ||||||
|
rplD |
Deletion | ||||||
|
rplD |
Deletion | ||||||
|
rplDT131I |
T131I |
Does not regulate the S10 operon; assembles into ribosomes in vivo |
seeded from UniProt:P60723 | ||||
|
rplD1 |
|||||||
|
rplD282 |
|||||||
|
rplD in strain TS15-23 |
Resistant to |
Two step Tiamulin resistant |
strain: TS15-23 |
table 1 and 2 | |||
|
rplD in strain N282 |
Resistant to |
Mutant with altered protein 50-8 (L4) is resistant to erythromycin |
Strain N282 |
||||
|
rplD5 |
Resistant to |
Resistant to erythromycin at the permissive temperature of 42C. |
Strain: 345-05 |
See table 6 | |||
|
rplD20 |
Resistant to |
Resistant to erythromycin |
Strain: 345-20 |
See table 6 | |||
| edit table |
<protect></protect>
Notes
Genetic Interactions
<protect>
| Interactor | Interaction | Allele | Score(s) | Reference(s) | Accessions | Notes |
|---|---|---|---|---|---|---|
| edit table |
</protect>
Notes
Genetic Resources
See Help:Gene_resources for help entering information into the Genetic Resources table.
| Resource | Resource Type | Source | Notes/Reference |
|---|---|---|---|
|
JW3281 |
Plasmid clone |
Status:Clone OK Primer 1:GCCGAATTAGTATTGAAAGACGC Primer 2:CCTGCCAGCATCTCCTCAACTTG | |
|
Kohara Phage |
|||
|
Kohara Phage |
|||
|
Linked marker |
est. P1 cotransduction: 46% [9] | ||
|
Linked marker |
est. P1 cotransduction: 8% [9] | ||
| edit table |
<protect></protect>
Notes
Accessions in Other Databases
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
| Database | Accession | Notes |
|---|---|---|
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
| edit table |
<protect></protect>
Notes
Links
| Name | URL | Comments |
|---|---|---|
| edit table |
<protect>
References
See Help:References for how to manage references in EcoliWiki.
- ↑ Riley, M. et al. (2006) Nucleic Acids Res 34:1-6 (corrected supplemental data from B. Wanner)
- ↑ Link, AJ et al. (1997) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis 18 1259-313 PubMed
- ↑ 3.0 3.1 3.2 Pardo, D & Rosset, R (1977) Properties of ribosomes from erythromycin resistant mutants of Escherichia coli. Mol. Gen. Genet. 156 267-71 PubMed
- ↑ Hummel, H et al. (1979) Analysis of lincomycin resistance mutations in Escherichia coli. Mol. Gen. Genet. 169 345-7 PubMed
- ↑ Wittmann, HG et al. (1973) Biochemical and genetic studies on two different types of erythromycin resistant mutants of Escherichia coli with altered ribosomal proteins. Mol. Gen. Genet. 127 175-89 PubMed
- ↑ Kitagawa, M et al. (2005) Complete set of ORF clones of Escherichia coli ASKA library (a complete set of E. coli K-12 ORF archive): unique resources for biological research. DNA Res. 12 291-9 PubMed
- ↑ 7.0 7.1 Kohara, Y et al. (1987) The physical map of the whole E. coli chromosome: application of a new strategy for rapid analysis and sorting of a large genomic library. Cell 50 495-508 PubMed
- ↑ 8.0 8.1 CGSC: The Coli Genetics Stock Center
- ↑ 9.0 9.1 The Tn10 insertion sites determined by Nichols et al. 1998 (PMID:9829956) were reannotated by alignment with E. coli K-12 genome sequence (GenBank accession NC_000913). P1 contransduction frequencies were calculated using the formula of Wu (PMID:5338813).
