ilvG:On One Page
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
Quickview | | Gene | | Product(s) | | Expression| | Evolution | | References | |
Quickview
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;}
h2 .editsection { display:none;}</css>
<protect>
Standard Name |
ilvG |
---|---|
Gene Synonym(s) |
Note that this is a pseudogene in K-12 strains., ECK3760, ilvO, JW3740, JW3741, b4488 |
Product Desc. |
Note that this is a pseudogene in K-12 strains. acetolactate synthase II, large subunit, N-ter fragment (pseudogene)[1][2]; acetolactate synthase II, large subunit, C-ter fragment (pseudogene)[1][2]; |
Product Synonyms(s) |
IlvO[1], IlvG_1[1], IlvG[1], B3767[1], B3768[1], IlvG_2[1] , ECK3760, ilvO, JW3740, JW3741, b4488 |
Function from GO |
<GO_nr /> |
Knock-Out Phenotype | |
Regulation/Expression |
transcription unit(s): ilvLG_1G_2MEDA[1], ilvLGGMEDA, ilvLGMEDA, ilvGMEDA |
Regulation/Activity | |
Quick Links | |
edit table |
</protect> See Help:Quickview for help with entering information in the Quickview table. <protect></protect>
Notes
This is a pseudogene in K-12 strains. The defective K-12 allele results in "valine resistance"; strain cannot grow in the absence of isoleucine when valine is present.
Gene
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;}
h2 .editsection { display:none;}</css>
<protect>
Nomenclature
See Help:Gene_nomenclature for help with entering information in the Gene Nomenclature table.
Standard name |
ilvG |
---|---|
Mnemonic | |
Synonyms |
Note that this is a pseudogene in K-12 strains., ECK3760, ilvO, JW3740, JW3741, b4488 |
edit table |
</protect>
Notes
Location(s) and DNA Sequence
<protect>
See Help:Gene_location for help entering information in the Gene Location and DNA sequence table.
Strain | Map location | Genome coordinates | Genome browsers | Sequence links |
---|---|---|---|---|
MG1655 |
85.1 minutes |
MG1655: 3948583..3949566 |
||
W3110 |
|
W3110: 3686121..3685138 |
||
MG1655 |
85.13 minutes, 85.13 minutes |
MG1655: 3949646..3950227 |
||
W3110 |
|
W3110: 3685058..3684477 |
||
MG1655 |
|
MG1655: 3948583..3950227 |
||
W3110 |
|
W3110: 3686121..3684477 |
||
edit table |
</protect>
Notes
Sequence Features
See Help:Gene_sequence_features for help in entering sequence features in EcoliWiki.
Feature Type | Strain | Genomic Location | Evidence | Reference | Notes |
---|---|---|---|---|---|
edit table |
<protect></protect>
Notes
Alleles and Phenotypes
See Help:Gene_alleles for how to enter or edit alleles and phenotypes in EcoliWiki.
Allele | Nt change(s) | AA change(s) | Phenotype: Type | Phenotype: Description | Reference | Availability | Comments |
---|---|---|---|---|---|---|---|
ilvG605(Am) |
amber (UAG) mutation | ||||||
ilvG603(Act) |
|||||||
ilvG468(Act) |
|||||||
ilvO-264 |
|||||||
ilvO-267 |
|||||||
ilvO-266 |
|||||||
ΔilvG789::kan |
PMID:16738554 |
||||||
ΔilvG790::kan |
PMID:16738554 |
||||||
ilvG in strain CU2501 |
Resistant to |
Resistance to glycyl-leucine |
PMID:4562390 |
Strain: CU2501 |
| ||
edit table |
<protect></protect>
Notes
Genetic Interactions
<protect>
Interactor | Interaction | Allele | Score(s) | Reference(s) | Accessions | Notes |
---|---|---|---|---|---|---|
edit table |
</protect>
Notes
Genetic Resources
See Help:Gene_resources for help entering information into the Genetic Resources table.
Resource | Resource Type | Source | Notes/Reference |
---|---|---|---|
Plasmid clone |
PMID:16769691 Status: Primer 1: Primer 2: | ||
Kohara Phage |
PMID:3038334 | ||
Kohara Phage |
PMID:3038334 | ||
Kohara Phage |
PMID:3038334 | ||
Linked marker |
est. P1 cotransduction: 49% [4] | ||
Linked marker |
est. P1 cotransduction: 90% [4] | ||
edit table |
<protect></protect>
Notes
Accessions in Other Databases
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
Database | Accession | Notes |
---|---|---|
Escherichia coli str. K-12 substr. MG1655 | ||
RegulonDB:ECK120000491 |
Escherichia coli str. K-12 substr. MG1655 | |
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
edit table |
<protect></protect>
Notes
Links
Name | URL | Comments |
---|---|---|
edit table |
Product(s)
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;}
h2 .editsection { display:none;}</css>
Nomenclature
See Help:Product_nomenclature for help entering or editing information in this section of EcoliWiki.
Standard name |
IlvG |
---|---|
Synonyms |
IlvO[1], IlvG_1[1], IlvG[1], B3767[1], B3768[1], IlvG_2[1] , ECK3760, ilvO, JW3740, JW3741, b4488 |
Product description |
Note that this is a pseudogene in K-12 strains. acetolactate synthase II, large subunit, N-ter fragment (pseudogene)[1][2]; acetolactate synthase II, large subunit, C-ter fragment (pseudogene)[1][2]; |
EC number (for enzymes) |
|
edit table |
<protect></protect>
Notes
Function
<protect>
Gene Ontology
See Help:Gene_ontology for help entering or editing GO terms and GO annotations in EcoliWiki.
Qualifier | GO ID | GO term name | Reference | Evidence Code | with/from | Aspect | Notes | Status |
---|---|---|---|---|---|---|---|---|
GO:0000287 |
magnesium ion binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR000399 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0000287 |
magnesium ion binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012000 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0000287 |
magnesium ion binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012846 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0000287 |
magnesium ion binding |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0460 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0003824 |
catalytic activity |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR011766 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0003984 |
acetolactate synthase activity |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012846 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0003984 |
acetolactate synthase activity |
GOA:spec |
IEA: Inferred from Electronic Annotation |
EC:2.2.1.6 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0008652 |
cellular amino acid biosynthetic process |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0028 |
P |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0009082 |
branched chain family amino acid biosynthetic process |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012846 |
P |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0009082 |
branched chain family amino acid biosynthetic process |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0100 |
P |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0016740 |
transferase activity |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR000399 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0016740 |
transferase activity |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0808 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0030976 |
thiamin pyrophosphate binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR000399 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0030976 |
thiamin pyrophosphate binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR011766 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0030976 |
thiamin pyrophosphate binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012000 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0030976 |
thiamin pyrophosphate binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012001 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0030976 |
thiamin pyrophosphate binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012846 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0046872 |
metal ion binding |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0479 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0050660 |
FAD binding |
GOA:interpro |
IEA: Inferred from Electronic Annotation |
InterPro:IPR012846 |
F |
Seeded from EcoCyc (v14.0) |
complete | |
edit table |
Interactions See Help:Product_interactions for help entering or editing information about gene product interactions in this section of EcoliWiki.
Partner Type | Partner | Notes | References | Evidence |
---|---|---|---|---|
Protein |
Subunits of AHAS |
could be indirect |
||
Protein |
galR |
PMID:16606699 |
Experiment(s):EBI-1146651 | |
edit table |
</protect>
Notes
Localization
See Help:Product_localization for how to add or edit information in this section of EcoliWiki.
Compartment | Description | Evidence | Reference/Source | Notes |
---|---|---|---|---|
edit table |
<protect></protect>
Notes
Structure and Physical Properties
<protect>
Physical Properties
See Help:Product_physical_properties for help entering or editing information about the physical properties of this gene product.
Name | |
---|---|
Sequence |
MNGAQWVVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGVCIAT SGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSFLVQSLEELPRIMAE AFDVACSGRPGPVLVDIPKDIQLASGDLEPWFTTVENEVTFPHAEVEQARQMLAKAQKPMLYVGGGVGMA QAVPALREFLAATKMPATCTLKGLGAVEADYPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGK LNTFAPHASVIHMDIDPAEMNKLRQAHVALQGDLNALLPALQQPLNINDWQLHCAQLRDEHAWRYDHPGD AIYAPLLLKQLSDRKPADCVVTTDVGQHQMWAAQHIAHTRPENFITSSGLGTMGFGLPAAVGAQVARPND TVVCISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTDNPDFLMLASA FGIPGQHITRKDQVEAALDTMLNSDGPYLLHVSIDELENVWPLVPPGASNSEMLEKLS |
Length |
548 |
Mol. Wt |
59.149 kDa |
pI |
5.2 (calculated) |
Extinction coefficient |
56,380 - 57,505 (calc based on 12 Y, 7 W, and 9 C residues) |
edit table |
Domains/Motifs/Modification Sites
See Help:Product_domains_motifs for help entering or editing information in this section of EcoliWiki.
|
<motif_map/> |
Structure
| </protect>
Structure figures<protect> | ||||||
Notes
Gene Product Resources
See Help:Product_resources for help with entering or editing information in this section of EcoliWiki.
Resource type | Source | Notes/Reference |
---|---|---|
edit table |
<protect></protect>
Notes
Accessions in Other Databases
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
Database | Accession | Notes |
---|---|---|
Escherichia coli str. K-12 substr. MG1655 | ||
Escherichia coli str. K-12 substr. MG1655 | ||
Escherichia coli str. K-12 substr. MG1655 | ||
Escherichia coli str. K-12 substr. MG1655 | ||
Escherichia coli str. K-12 substr. MG1655 | ||
EcoCyc: |
Escherichia coli str. K-12 substr. MG1655 | |
RegulonDB:ECK120000491 |
Escherichia coli str. K-12 substr. MG1655 | |
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
edit table |
<protect></protect>
Notes
Links
Name | URL | Comments |
---|---|---|
edit table |
Expression
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;}
h2 .editsection { display:none;}</css>
Overview
This is a placeholder for a summary statement on how expression of this gene product is regulated. You can help EcoliWiki by becoming a user and writing/editing this statement.
Cellular Levels
Molecule | Organism or Strain | Value | Units | Experimental Conditions | Assay used | Notes | Reference(s) |
---|---|---|---|---|---|---|---|
edit table |
Notes
Transcription and Transcriptional Regulation
<protect>
See Help:Expression_transcription for help entering or editing information in this section of EcoliWiki.
|
</protect>
Notes
This is a placeholder for a summary statement about how transcription of this gene is regulated. You can help EcoliWiki by becoming a user and writing/editing this statement.
Translation and Regulation of Translation
<protect><gbrowseImage>
name=NC_000913:3948563..3948603
source=MG1655
type=Gene+DNA_+Protein
preset=Nterminus
</gbrowseImage>
This picture shows the sequence around the N-terminus.
</protect>
Notes
This is a placeholder for a summary statement about how translation of this gene product is regulated. You can help EcoliWiki by becoming a user and writing/editing this statement.
Turnover and Regulation of Turnover
</protect>
Notes
This is a placeholder for a summary statement about turnover of this gene product. You can help EcoliWiki by becoming a user and writing/editing this statement.
Experimental
<protect>
Mutations Affecting Expression
See Help:Expression_mutations for help entering or editing information in this section of EcoliWiki.
Allele Name | Mutation | Phenotype | Reference |
---|---|---|---|
edit table |
Expression Studies
See Help:Expression_studies for help entering or editing information in this section of EcoliWiki.
Type | Reference | Notes |
---|---|---|
microarray |
NCBI GEO profiles for ilvG_2 | |
microarray |
Summary of data for ilvG_2 from multiple microarray studies | |
edit table |
Expression Resources
See Help:Expression_resources for help entering or editing information in this section of EcoliWiki.
Resource Name | Resource Type | Description | Source | Notes |
---|---|---|---|---|
edit table |
<protect></protect>
Notes
Accessions Related to ilvG Expression
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
Database | Accession | Notes |
---|---|---|
RegulonDB:ECK120000491 |
Escherichia coli str. K-12 substr. MG1655 | |
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
ASAP: |
Escherichia coli str. K-12 substr. MG1655 | |
edit table |
<protect></protect>
Notes
Links
Name | URL | Comments |
---|---|---|
edit table |
Evolution
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;}
h2 .editsection { display:none;}</css>
Homologs in Other Organisms
See Help:Evolution_homologs for help entering or editing information in this section of EcoliWiki.
Organism | Homologs (Statistics) | Comments |
---|---|---|
Shigella flexneri |
ILVG |
From SHIGELLACYC |
E. coli O157 |
ILVG |
From ECOO157CYC |
edit table |
<protect></protect>
Notes
Families
<protect>
See Help:Evolution_families for help entering or editing information in this section of EcoliWiki.
Database | Accession | Notes |
---|---|---|
PF02775 Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
||
PF02776 Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| |
edit table |
</protect> <protect></protect>
Notes
Links
Name | URL | Comments |
---|---|---|
edit table |
References
See Help:References for how to manage references in EcoliWiki.
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 EcoCyc (release 10.6; 2007) Keseler, IM et al. (2005) Nucleic Acids Res. 33(Database issue):D334-7
- ↑ 2.0 2.1 2.2 2.3 EcoCyc (release 11.1; 2007) Keseler, IM et al. (2005) Nucleic Acids Res. 33(Database issue):D334-7
- ↑ 3.0 3.1 CGSC: The Coli Genetics Stock Center
- ↑ 4.0 4.1 The Tn10 insertion sites determined by Nichols et al. 1998 (PMID:9829956) were reannotated by alignment with E. coli K-12 genome sequence (GenBank accession NC_000913). P1 contransduction frequencies were calculated using the formula of Wu (PMID:5338813).
Categories