sgrT:On One Page
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
Quickview | | Gene | | Product(s) | | Expression| | Evolution | | References | |
Quickview
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
References | Suggestions |
<protect><protect>
Standard Name |
sgrT |
---|---|
Gene Synonym(s) |
b4662, ECK4477 |
Product Desc. |
Inhibitor of glucose uptake[1] |
Product Synonyms(s) |
EG14467; ECK4477; b4662[1], ECK4477, b4662 |
Function from GO |
<GO_nr /> |
Knock-Out Phenotype | |
Regulation/Expression | |
Regulation/Activity | |
Quick Links | |
edit table |
</protect> </protect> <protect></protect>
Notes
SgrT is encoded within the sgrS sRNA and translated during glucose-phosphate stress; overproduction prevents inducer exclusion and inhibits glucose uptake, probably by interfering with PtsG activity (Wadler, 2007). [1]
References
See Help:References for how to manage references in EcoliWiki.
Gene
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
Nomenclature | Location(s) and DNA Sequence | Sequence Features | Alleles and Phenotypes | Genetic Interactions | Genetic Resources | Accessions | Links | References | Suggestions |
<protect>
Nomenclature
<protect>
See Help:Gene_nomenclature for help with entering information in the Gene Nomenclature table.
Standard name |
sgrT |
---|---|
Mnemonic | |
Synonyms |
b4662, ECK4477 |
edit table |
</protect> </protect>
Notes
Location(s) and DNA Sequence
<protect>
<protect>
See Help:Gene_location for help entering information in the Gene Location and DNA sequence table.
Strain | Map location | Genome coordinates | Genome browsers | Sequence links |
---|---|---|---|---|
MG1655 |
1.67 minutes |
MG1655: 77388..77519 |
| |
edit table |
</protect> </protect>
Notes
Sequence Features
<protect>
See Help:Gene_sequence_features for help in entering sequence features in EcoliWiki.
Feature Type | Strain | Genomic Location | Evidence | Reference | Notes |
---|---|---|---|---|---|
edit table |
</protect> <protect></protect>
Notes
Alleles and Phenotypes
<protect>
See Help:Gene_alleles for how to enter or edit alleles and phenotypes in EcoliWiki.
Allele | Nt change(s) | AA change(s) | Phenotype: Type | Phenotype: Description | Reference | Availability | Comments |
---|---|---|---|---|---|---|---|
edit table |
</protect> <protect></protect>
Notes
Genetic Interactions
<protect>
Interactor | Interaction | Allele | Score(s) | Reference(s) | Accessions | Notes |
---|---|---|---|---|---|---|
edit table |
</protect>
Notes
Genetic Resources
<protect>
See Help:Gene_resources for help entering information into the Genetic Resources table.
Resource | Resource Type | Source | Notes/Reference |
---|---|---|---|
edit table |
</protect> <protect></protect>
Notes
Accessions in Other Databases
<protect>
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
Database | Accession | Notes |
---|---|---|
EcoGene:EG14467 |
Escherichia coli str. K-12 substr. MG1655 | |
EcoCyc:G0-10617 |
Escherichia coli str. K-12 substr. MG1655 | |
Escherichia coli str. K-12 substr. MG1655 | ||
RegulonDB:ECK120033551 |
Escherichia coli str. K-12 substr. MG1655 | |
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
ASAP: |
Escherichia coli str. K-12 substr. MG1655 | |
edit table |
</protect> <protect></protect>
Notes
Links
<protect>
Name | URL | Comments |
---|---|---|
edit table |
</protect>
References
See Help:References for how to manage references in EcoliWiki.
Categories
Product(s)
{{#css:Suppresslinks.css}} <css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
Nomenclature | Function | Interactions | Localization | Sequence | Domains | Structure | Resources | Accessions | Links | References | Suggestions |
Nomenclature
<protect> See Help:Product_nomenclature for help entering or editing information in this section of EcoliWiki.
Standard name |
SgrT |
---|---|
Synonyms |
EG14467; ECK4477; b4662[1], ECK4477, b4662 |
Product description |
Inhibitor of glucose uptake[1] |
EC number (for enzymes) |
|
edit table |
</protect> <protect></protect>
Notes
Function
<protect>
Gene Ontology
<protect>
See Help:Gene_ontology for help entering or editing GO terms and GO annotations in EcoliWiki.
Qualifier | GO ID | GO term name | Reference | Evidence Code | with/from | Aspect | Notes | Status |
---|---|---|---|---|---|---|---|---|
GO:0008643 |
carbohydrate transport |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0762 |
P |
Seeded from EcoCyc (v14.0) |
complete | |
GO:0009401 |
phosphoenolpyruvate-dependent sugar phosphotransferase system |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
SP_KW:KW-0598 |
P |
Seeded from EcoCyc (v14.0) |
complete | |
edit table |
</protect>
Interactions <protect> See Help:Product_interactions for help entering or editing information about gene product interactions in this section of EcoliWiki.
Partner Type | Partner | Notes | References | Evidence |
---|---|---|---|---|
edit table |
</protect> </protect>
Notes
Localization
<protect> See Help:Product_localization for how to add or edit information in this section of EcoliWiki.
Compartment | Description | Evidence | Reference/Source | Notes |
---|---|---|---|---|
edit table |
</protect> <protect></protect>
Notes
Structure and Physical Properties
<protect>
Physical Properties
<protect>
See Help:Product_physical_properties for help entering or editing information about the physical properties of this gene product.
Name | |
---|---|
Sequence |
MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES |
Length |
43 |
Mol. Wt |
5.337 kDa |
pI |
8.1 (calculated) |
Extinction coefficient |
19,480 - 19,605 (calc based on 2 Y, 3 W, and 1 C residues) |
edit table |
</protect>
Domains/Motifs/Modification Sites <protect> See Help:Product_domains_motifs for help entering or editing information in this section of EcoliWiki.
Type | Residues | Description | Notes | References |
---|---|---|---|---|
edit table |
</protect>
Structure
</protect> | </protect>
Structure figures<protect> | ||||||
Notes
Gene Product Resources
<protect>
See Help:Product_resources for help with entering or editing information in this section of EcoliWiki.
Resource type | Source | Notes/Reference |
---|---|---|
edit table |
</protect> <protect></protect>
Notes
Accessions in Other Databases
<protect>
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
Database | Accession | Notes |
---|---|---|
Escherichia coli str. K-12 substr. MG1655 | ||
Escherichia coli str. K-12 substr. MG1655 | ||
EcoGene:EG14467 |
Escherichia coli str. K-12 substr. MG1655 | |
Escherichia coli str. K-12 substr. MG1655 | ||
EcoCyc:G0-10617 |
Escherichia coli str. K-12 substr. MG1655 | |
RegulonDB:ECK120033551 |
Escherichia coli str. K-12 substr. MG1655 | |
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
ASAP: |
Escherichia coli str. K-12 substr. MG1655 | |
edit table |
</protect> <protect></protect>
Notes
Links
<protect>
Name | URL | Comments |
---|---|---|
edit table |
</protect>
References
See Help:References for how to manage references in EcoliWiki.
Categories
Expression
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
Overview | Transcription | Translation | Turnover | Experimental | Links | References | Suggestions |
Overview
Cellular Levels
<protect>
See Help:Cellular levels
Molecule | Organism or Strain | Value | Units | Experimental Conditions | Assay used | Notes | Reference(s) |
---|---|---|---|---|---|---|---|
Protein |
E. coli K-12 MG1655 |
0a |
molecules/cell/generation |
|
Ribosome Profiling |
Low confidence in the sequencing data set. |
PMID: 24766808 |
Protein |
E. coli K-12 MG1655 |
0a |
molecules/cell/generation |
|
Ribosome Profiling |
Low confidence in the sequencing data set. |
PMID: 24766808 |
Protein |
E. coli K-12 MG1655 |
0a |
molecules/cell/generation |
|
Ribosome Profiling |
Low confidence in the sequencing data set. |
PMID: 24766808 |
edit table |
</protect>
Notes
Transcription and Transcriptional Regulation
<protect>
<protect>
See Help:Expression_transcription for help entering or editing information in this section of EcoliWiki.
</protect>|| |
</protect>
Notes
Translation and Regulation of Translation
<protect>
</protect>
Notes
Turnover and Regulation of Turnover
</protect>
Notes
Experimental
<protect>
Mutations Affecting Expression
<protect>
See Help:Expression_mutations for help entering or editing information in this section of EcoliWiki.
Allele Name | Mutation | Phenotype | Reference |
---|---|---|---|
edit table |
</protect>
Expression Studies <protect> See Help:Expression_studies for help entering or editing information in this section of EcoliWiki.
Type | Reference | Notes |
---|---|---|
edit table |
</protect>
Expression Resources <protect> See Help:Expression_resources for help entering or editing information in this section of EcoliWiki.
Resource Name | Resource Type | Description | Source | Notes |
---|---|---|---|---|
edit table |
</protect> <protect></protect>
Notes
Accessions Related to sgrT Expression
<protect>
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
Database | Accession | Notes |
---|---|---|
EcoCyc:G0-10617 |
Escherichia coli str. K-12 substr. MG1655 | |
EcoGene:EG14467 |
Escherichia coli str. K-12 substr. MG1655 | |
RegulonDB:ECK120033551 |
Escherichia coli str. K-12 substr. MG1655 | |
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
ASAP: |
Escherichia coli str. K-12 substr. MG1655 | |
edit table |
</protect> <protect></protect>
Notes
Links
<protect>
Name | URL | Comments |
---|---|---|
edit table |
</protect>
References
See Help:References for how to manage references in EcoliWiki.
Categories
Evolution
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
Homologs | Families | Links | References | Suggestions |
Homologs in Other Organisms
<protect>
See Help:Evolution_homologs for help entering or editing information in this section of EcoliWiki.
Organism | Homologs (Statistics) | Comments |
---|---|---|
edit table |
</protect>
Do-It-Yourself Web Tools
<protect></protect>
Notes
Families
<protect>
See Help:Evolution_families for help entering or editing information in this section of EcoliWiki.
Database | Accession | Notes |
---|---|---|
edit table |
</protect> <protect></protect>
Notes
Links
<protect>
Name | URL | Comments |
---|---|---|
edit table |
</protect>
References
See Help:References for how to manage references in EcoliWiki.
Categories
[[Category:]]