sgrT:Gene Product(s)
{{#css:Suppresslinks.css}} <css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
| Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
| Nomenclature | Function | Interactions | Localization | Sequence | Domains | Structure | Resources | Accessions | Links | References | Suggestions |
Nomenclature
<protect> See Help:Product_nomenclature for help entering or editing information in this section of EcoliWiki.
| Standard name |
SgrT |
|---|---|
| Synonyms |
EG14467; ECK4477; b4662[1], ECK4477, b4662 |
| Product description |
Inhibitor of glucose uptake[1] |
| EC number (for enzymes) |
|
| edit table |
</protect> <protect></protect>
Notes
Function
<protect>
Gene Ontology
<protect>
See Help:Gene_ontology for help entering or editing GO terms and GO annotations in EcoliWiki.
| Qualifier | GO ID | GO term name | Reference | Evidence Code | with/from | Aspect | Notes | Status |
|---|---|---|---|---|---|---|---|---|
| GO:0008643 |
carbohydrate transport |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
P |
Seeded from EcoCyc (v14.0) |
complete | ||
| GO:0009401 |
phosphoenolpyruvate-dependent sugar phosphotransferase system |
GOA:spkw |
IEA: Inferred from Electronic Annotation |
P |
Seeded from EcoCyc (v14.0) |
complete | ||
| edit table |
</protect>
Interactions <protect> See Help:Product_interactions for help entering or editing information about gene product interactions in this section of EcoliWiki.
| Partner Type | Partner | Notes | References | Evidence |
|---|---|---|---|---|
| edit table |
</protect> </protect>
Notes
Localization
<protect> See Help:Product_localization for how to add or edit information in this section of EcoliWiki.
| Compartment | Description | Evidence | Reference/Source | Notes |
|---|---|---|---|---|
| edit table |
</protect> <protect></protect>
Notes
Structure and Physical Properties
<protect>
Physical Properties
<protect>
See Help:Product_physical_properties for help entering or editing information about the physical properties of this gene product.
| Name | |
|---|---|
| Sequence |
MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES |
| Length |
43 |
| Mol. Wt |
5.337 kDa |
| pI |
8.1 (calculated) |
| Extinction coefficient |
19,480 - 19,605 (calc based on 2 Y, 3 W, and 1 C residues) |
| edit table |
</protect>
Domains/Motifs/Modification Sites <protect> See Help:Product_domains_motifs for help entering or editing information in this section of EcoliWiki.
| Type | Residues | Description | Notes | References |
|---|---|---|---|---|
| edit table |
</protect>
|
Structure
</protect> | </protect>
Structure figures<protect> | ||||||
Notes
Gene Product Resources
<protect>
See Help:Product_resources for help with entering or editing information in this section of EcoliWiki.
| Resource type | Source | Notes/Reference |
|---|---|---|
| edit table |
</protect> <protect></protect>
Notes
Accessions in Other Databases
<protect>
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
| Database | Accession | Notes |
|---|---|---|
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
EchoBASE: |
Escherichia coli str. K-12 substr. MG1655 | |
|
ASAP: |
Escherichia coli str. K-12 substr. MG1655 | |
| edit table |
</protect> <protect></protect>
Notes
Links
<protect>
| Name | URL | Comments |
|---|---|---|
| edit table |
</protect>
References
See Help:References for how to manage references in EcoliWiki.
Categories
