rpsD:Gene
{{#css:Suppresslinks.css}}<css>h1 .editsection { display:none;} h2 .editsection { display:none;}</css>
| Quickview | Gene | Gene Product(s) | Expression | Evolution | On One Page |
| Nomenclature | Location(s) and DNA Sequence | Sequence Features | Alleles and Phenotypes | Genetic Interactions | Genetic Resources | Accessions | Links | References | Suggestions |
<protect>
Nomenclature
See Help:Gene_nomenclature for help with entering information in the Gene Nomenclature table.
| Standard name |
rpsD |
|---|---|
| Mnemonic |
Ribosomal protein, small |
| Synonyms |
ECK3283, b3296, JW3258, ramA, sud(2), sud2[1], sud |
| edit table |
</protect>
Notes
Location(s) and DNA Sequence
<protect>
See Help:Gene_location for help entering information in the Gene Location and DNA sequence table.
| Strain | Map location | Genome coordinates | Genome browsers | Sequence links |
|---|---|---|---|---|
|
MG1655 |
74.12 minutes |
MG1655: 3439697..3439077 |
||
|
NC_012967: 3369580..3368960 |
||||
|
NC_012759: 3326234..3326854 |
||||
|
W3110 |
|
W3110: 4198741..4199361 |
||
|
DH10B: 3537442..3536822 |
||||
| edit table |
</protect>
Notes
Sequence Features
See Help:Gene_sequence_features for help in entering sequence features in EcoliWiki.
| Feature Type | Strain | Genomic Location | Evidence | Reference | Notes |
|---|---|---|---|---|---|
|
Coding Start (SO:0000323) |
3439080 |
Edman degradation |
| ||
| edit table |
<protect></protect>
Notes
Alleles and Phenotypes
See Help:Gene_alleles for how to enter or edit alleles and phenotypes in EcoliWiki.
| Allele | Nt change(s) | AA change(s) | Phenotype: Type | Phenotype: Description | Reference | Availability | Comments |
|---|---|---|---|---|---|---|---|
|
rpsDY51D |
Y51D |
(in rpsD101; suppresses a temperature-sensitive mutant of release factor 1, R137P. Not a ram mutation) |
Strain variation; seeded from UniProt:P0A7V8 | ||||
|
rpsD |
Deletion | ||||||
|
rpsDKMEGTFKRKPERSDLSADINEHLIVELYSK177GRYV |
KMEGTFKRKPERSDLSADINEHLIVELYSK177GRYV |
(in rpsD12; suppresses streptomycin dependence in protein S12. A ram mutation) |
Strain variation; seeded from UniProt:P0A7V8 | ||||
|
rpsDEGTFKRKPERSDLSADINEHLIVELYSK179ARYV |
EGTFKRKPERSDLSADINEHLIVELYSK179ARYV |
(in rpsD14; suppresses streptomycin dependence in protein S12. A ram mutation) |
Strain variation; seeded from UniProt:P0A7V8 | ||||
|
rpsDRKPR44AKPA |
RKPR44AKPA |
Decreases mRNA unwinding ability of the ribosome |
seeded from UniProt:P0A7V8 | ||||
|
rpsD1 |
|||||||
|
rpsD2000 |
|||||||
|
rpsD2001 |
|||||||
|
rpsD4 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A8 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
rpsD4 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A26 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
rpsD6 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A8 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
rpsL1rpsD4 |
Insertion of SmI mutation into proteins rpsL and rpsD |
Sensitivity to |
Insertion of streptomycin independence rpsL and rpsD induced significantly greater reactivity with DMS at position A8. |
See Figure 1 for the Autoradiograph | |||
|
rpsD6 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A26 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
rpsL1rpsD4 |
Insertion of SmI mutation into proteins rpsL and rpsD |
Sensitivity to |
Insertion of streptomycin independence into both the rpsL and rpsD induced significantly greater reactivity with DMS at position A26. |
See Figure 1 for the Autoradiograph | |||
| edit table |
<protect></protect>
Notes
Genetic Interactions
<protect>
| Interactor | Interaction | Allele | Score(s) | Reference(s) | Accessions | Notes |
|---|---|---|---|---|---|---|
| edit table |
</protect>
Notes
Genetic Resources
See Help:Gene_resources for help entering information into the Genetic Resources table.
| Resource | Resource Type | Source | Notes/Reference |
|---|---|---|---|
|
JW3258 |
Plasmid clone |
Status:Clone OK Primer 1:GCCGCAAGATATTTGGGTCCTAA Primer 2:CCtTTGGAGTAAAGCTCGACGAT | |
|
Kohara Phage |
|||
|
Linked marker |
est. P1 cotransduction: 70% [8] | ||
|
Linked marker |
est. P1 cotransduction: 3% [8] | ||
| edit table |
<protect></protect>
Notes
Accessions in Other Databases
See Help:Gene_accessions for help with entering information into the Gene Accessions table.
| Database | Accession | Notes |
|---|---|---|
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
|
Escherichia coli str. K-12 substr. MG1655 | ||
| edit table |
<protect></protect>
Notes
Links
| Name | URL | Comments |
|---|---|---|
| edit table |
<protect>
References
See Help:References for how to manage references in EcoliWiki.
- ↑ Riley, M. et al. (2006) Nucleic Acids Res 34:1-6 (corrected supplemental data from B. Wanner)
- ↑ Schiltz, E & Reinbolt, J (1975) Determination of the complete amino-acid sequence of protein S4 from Escherichia coli ribosomes. Eur. J. Biochem. 56 467-81 PubMed
- ↑ Reinbolt, J & Schiltz, E (1973) The primary structure of ribosomal protein S4 from Escherichia coli. FEBS Lett. 36 250-2 PubMed
- ↑ 4.0 4.1 Allen, PN & Noller, HF (1989) Mutations in ribosomal proteins S4 and S12 influence the higher order structure of 16 S ribosomal RNA. J. Mol. Biol. 208 457-68 PubMed
- ↑ Kitagawa, M et al. (2005) Complete set of ORF clones of Escherichia coli ASKA library (a complete set of E. coli K-12 ORF archive): unique resources for biological research. DNA Res. 12 291-9 PubMed
- ↑ Kohara, Y et al. (1987) The physical map of the whole E. coli chromosome: application of a new strategy for rapid analysis and sorting of a large genomic library. Cell 50 495-508 PubMed
- ↑ 7.0 7.1 CGSC: The Coli Genetics Stock Center
- ↑ 8.0 8.1 The Tn10 insertion sites determined by Nichols et al. 1998 (PMID:9829956) were reannotated by alignment with E. coli K-12 genome sequence (GenBank accession NC_000913). P1 contransduction frequencies were calculated using the formula of Wu (PMID:5338813).
