TableEdit
rpsD:On One Page
You don't have sufficient rights on this wiki to edit tables. Perhaps you need to log in. Changes you make in the Table editor will not be saved back to the wiki
See Help for Help on this wiki. See the documentation for how to use the table editor
See Help:Gene_alleles for how to enter or edit alleles and phenotypes in EcoliWiki.
| Allele | Nt change(s) | AA change(s) | Phenotype: Type | Phenotype: Description | Reference | Availability | Comments | |
|---|---|---|---|---|---|---|---|---|
|
public |
rpsDY51D |
Y51D |
(in rpsD101; suppresses a temperature-sensitive mutant of release factor 1, R137P. Not a ram mutation) |
Strain variation; seeded from UniProt:P0A7V8 | ||||
|
public |
rpsD |
Deletion | ||||||
|
public |
rpsDKMEGTFKRKPERSDLSADINEHLIVELYSK177GRYV |
KMEGTFKRKPERSDLSADINEHLIVELYSK177GRYV |
(in rpsD12; suppresses streptomycin dependence in protein S12. A ram mutation) |
Strain variation; seeded from UniProt:P0A7V8 | ||||
|
public |
rpsDEGTFKRKPERSDLSADINEHLIVELYSK179ARYV |
EGTFKRKPERSDLSADINEHLIVELYSK179ARYV |
(in rpsD14; suppresses streptomycin dependence in protein S12. A ram mutation) |
Strain variation; seeded from UniProt:P0A7V8 | ||||
|
public |
rpsDRKPR44AKPA |
RKPR44AKPA |
Decreases mRNA unwinding ability of the ribosome |
seeded from UniProt:P0A7V8 | ||||
|
public |
rpsD1 |
|||||||
|
public |
rpsD2000 |
|||||||
|
public |
rpsD2001 |
|||||||
|
public |
rpsD4 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A8 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
public |
rpsD4 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A26 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
public |
rpsD6 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A8 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
public |
rpsL1rpsD4 |
Insertion of SmI mutation into proteins rpsL and rpsD |
Sensitivity to |
Insertion of streptomycin independence rpsL and rpsD induced significantly greater reactivity with DMS at position A8. |
PMID:2477554 |
See Figure 1 for the Autoradiograph | ||
|
public |
rpsD6 |
Insertion of ram mutation |
Sensitivity to |
Increased reactivity toward dimethyl sulfate at positions A26 16 S rRNA |
PIMD:2477554 |
See Figure 1. | ||
|
public |
rpsL1rpsD4 |
Insertion of SmI mutation into proteins rpsL and rpsD |
Sensitivity to |
Insertion of streptomycin independence into both the rpsL and rpsD induced significantly greater reactivity with DMS at position A26. |
PMID:2477554 |
See Figure 1 for the Autoradiograph |
| Cancel |
